PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G303700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 283aa    MW: 30419.6 Da    PI: 4.5513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G303700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-141462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        rg+W++eEd  l   v+++G+  +W + +++ g++R++k+c++rw++yl
  Sevir.5G303700.1.p 14 RGPWSQEEDAVLRSFVERFGNAgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                        89******************99*************************97 PP

2Myb_DNA-binding39.51.3e-1269111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +T eEd l++ +    G++ W+ Ia++++ gRt++++k++w++
  Sevir.5G303700.1.p  69 GGFTDEEDSLILSLYGDIGSK-WSVIASRLP-GRTDNDVKNYWNT 111
                         569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.283962IPR017930Myb domain
SuperFamilySSF466895.24E-2612109IPR009057Homeodomain-like
SMARTSM007171.1E-91364IPR001005SANT/Myb domain
PfamPF002494.5E-131462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-221569IPR009057Homeodomain-like
CDDcd001673.67E-71662No hitNo description
PROSITE profilePS5129418.95463117IPR017930Myb domain
SMARTSM007171.5E-1167115IPR001005SANT/Myb domain
PfamPF002492.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2270116IPR009057Homeodomain-like
CDDcd001673.11E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRSPCCDKT KVKRGPWSQE EDAVLRSFVE RFGNAGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPELRHGG FTDEEDSLIL SLYGDIGSKW SVIASRLPGR TDNDVKNYWN TKLKKRYLAS  120
TGEGRPPSPP PPPPPPASDD DSQSRHDEPP PPTPPPLANL DDTEYTGGGA VDDDALLLKS  180
EQLYAELVGL IEQQSSSSAA TTPSSSSGTS SPTASSSGSC TGTTVWAPSM DVHDTTLLSE  240
SSSSLFDAYG AGDAFGAVYS FQDLLAASYD EITAVTQELQ YY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-24141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413701e-133AK241370.1 Oryza sativa Japonica Group cDNA, clone: J065154C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969789.11e-160PREDICTED: myb-related protein Myb4-like
TrEMBLK3XRL51e-155K3XRL5_SETIT; Uncharacterized protein
STRINGSi004558m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.16e-68myb domain protein 87